SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A112VM51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A112VM51
Domain Number 1 Region: 244-307
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.97e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0032
Further Details:      
 
Weak hits

Sequence:  A0A112VM51
Domain Number - Region: 82-102
Classification Level Classification E-value
Superfamily BEACH domain 0.0405
Family BEACH domain 0.01
Further Details:      
 
Domain Number - Region: 123-222
Classification Level Classification E-value
Superfamily ADC synthase 0.0778
Family ADC synthase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A112VM51
Sequence length 321
Comment (tr|A0A112VM51|A0A112VM51_LISMN) Spore germination protein gerE {ECO:0000313|EMBL:CWW78985.1} KW=Complete proteome OX=1639 OS=Listeria monocytogenes. GN=ERS409707_01574 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MTFVFIYNILLIILYSFTSTFTLNLYLKNKQPIFLLLLFLMVIFICDNVIVYMTEFINSF
ATEYNQTFMTAPFLKTIIFICCNFAYLAIINTISGRPFKNYQFVWLFLIGLWMLAIPFSQ
NSALKVWLYYLPNQLFLIYLGCYALYQLRIDPLSALAKKYLRFIGWLSIGFGVAILLEDT
FVIFNIDQYSDIVFKINNRNVSEDIYTIILSIAIIYFCNRDFPLSVLEKDAAKLEENQSD
EPVLLAPFCDAYQLTQREREVLSLLLECKTNQDIANELFLSIGTVKTHIHNIFVKLEVSK
RAEVFVSYQLFSQQQTEHLAR
Download sequence
Identical sequences A0A112VM51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]