SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A118LBF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A118LBF3
Domain Number 1 Region: 9-147
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 5.07e-31
Family PA0094-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A118LBF3
Sequence length 152
Comment (tr|A0A118LBF3|A0A118LBF3_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KVL26002.1} KW=Complete proteome OX=1637876 OS=Burkholderia sp. MSMB1835. GN=WS96_00660 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MTDSENRIRIHEGSIVLPNGFEDRTTNLFVPADTAAQPNLSVARDWLKDGETLAPYIDRQ
IALLQSRLQGHRVLSRQAERLGPETDGMPGERIDAAYRNGPKTVFQRQGAFIVAPGRVLI
FTASSAKSFGETLDVLWRNWLDGYRPAEQESA
Download sequence
Identical sequences A0A118LBF3
WP_059837025.1.29304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]