SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A118PUY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A118PUY6
Domain Number 1 Region: 59-96
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000549
Family H-NS histone-like proteins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A118PUY6
Sequence length 108
Comment (tr|A0A118PUY6|A0A118PUY6_9BURK) Histone {ECO:0000313|EMBL:KVN20674.1} KW=Complete proteome OX=1636424 OS=Burkholderia sp. MSMB1552. GN=WT08_28215 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
MIVELQDLQAQLRGLNIRLADVKKDERAAYLAAVQEHVALYGITEDELLRAAGFRKSRKR
RAPAKYYDPSSGKSWSGHGPRPKWLEGKNLDDFLVERAAKPWWPGEEA
Download sequence
Identical sequences A0A118PUY6
WP_059928624.1.20003 WP_059928624.1.55749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]