SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A124SDZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A124SDZ8
Domain Number 1 Region: 4-235
Classification Level Classification E-value
Superfamily 14-3-3 protein 1.83e-105
Family 14-3-3 protein 0.00000000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A124SDZ8
Sequence length 259
Comment (tr|A0A124SDZ8|A0A124SDZ8_CYNCS) 14-3-3 domain-containing protein {ECO:0000313|EMBL:KVH98545.1} OX=59895 OS=Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus). GN=Ccrd_023231 OC=Carduoideae; Cardueae; Carduinae; Cynara.
Sequence
MALSAREQNVYMAKLAEQAERYDEMVEFMEKVSETDELTVEERNLLSVAYKNVIGARRAS
WRIISSIEQKEESRGNEDHVSVIKEYRSKIEAELSKICDGILKLLDSRLIPSASSGDSKV
FYLKMKGDYHRYLAEFKTGGDRKEAAESTLTAYKSAQDIANTELAPTHPIRLGLALNFSV
FYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEDG
ADEIKEAPAPKQGEEQQQQ
Download sequence
Identical sequences A0A124SDZ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]