SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A125WZL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A125WZL5
Domain Number - Region: 38-87
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0445
Family Capz alpha-1 subunit 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A125WZL5
Sequence length 191
Comment (tr|A0A125WZL5|A0A125WZL5_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:EYE22990.1} KW=Complete proteome OX=1444132 OS=Escherichia coli 1-110-08_S3_C1. GN=AB97_3430 OC=Enterobacteriaceae; Escherichia.
Sequence
MVRKISTFLKIIGVIGSLCGIIATVFTIYAYYNPTSPSTQRYDSIVGSWLSDYSYTVKGN
TVRVNGKTTFFSNGKYNFHGSISIDSNAPGDHILIDYLSDGAGDWELYDNELITSLNSLK
TKPMKLALNNEDLDPLKIEVINNKKLPTIEENMADGKNQSYKIIKSSKSQLTLEVINEIG
SNFNFTMQKTK
Download sequence
Identical sequences A0A125WZL5 A0A1E5MUL0
WP_032230123.1.24960 WP_032230123.1.31024 WP_032230123.1.3723 WP_032230123.1.38956 WP_032230123.1.85216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]