SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A126ZK78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A126ZK78
Domain Number 1 Region: 72-112
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.000000051
Family H-NS histone-like proteins 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A126ZK78
Sequence length 113
Comment (tr|A0A126ZK78|A0A126ZK78_9BURK) Histidine biosynthesis protein HisIE {ECO:0000313|EMBL:AMM25832.1} KW=Complete proteome; Reference proteome OX=1795631 OS=Variovorax sp. PAMC 28711. GN=AX767_16835 OC=Comamonadaceae; Variovorax.
Sequence
MPTLADINSQIQKHDEQIAQLRKQAEDMRNQERAGVVEELRKKIAEYGISAADLKLSGGR
GPAKRSGAPAAAKAAARYRGPAGETWSGGRGRKPRWVTEALAAGKPLSDFEIR
Download sequence
Identical sequences A0A126ZK78
WP_068632372.1.48365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]