SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A128G1Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A128G1Q9
Domain Number 1 Region: 7-87
Classification Level Classification E-value
Superfamily FlaG-like 0.00000732
Family FlaG-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A128G1Q9
Sequence length 93
Comment (tr|A0A128G1Q9|A0A128G1Q9_LEGPN) Uncharacterized protein {ECO:0000313|EMBL:KXB24191.1} KW=Complete proteome OX=446 OS=Legionella pneumophila. GN=BJK08_06325 OC=Legionellaceae; Legionella.
Sequence
MSIEPVPSVNKAAQTDQIKIVEEASKPEIKSMVYDSALDAETKQALDKATGLLQTIITEK
ISDKVLRKMPSDEYLQLLSLLDDIISGSIDKHV
Download sequence
Identical sequences A0A128G1Q9
WP_027226852.1.100653 WP_027226852.1.14160 WP_027226852.1.22644 WP_027226852.1.33239 WP_027226852.1.39047 WP_027226852.1.41771 WP_027226852.1.52625 WP_027226852.1.58394 WP_027226852.1.66871 WP_027226852.1.69425 WP_027226852.1.74594 WP_027226852.1.80998 WP_027226852.1.86175 WP_027226852.1.90390 WP_027226852.1.94812 WP_027226852.1.96607 WP_027226852.1.97854 WP_027226852.1.99517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]