SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A128GUR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A128GUR2
Domain Number - Region: 6-75
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0314
Family EspA chaperone CesA 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A128GUR2
Sequence length 243
Comment (tr|A0A128GUR2|A0A128GUR2_LEGPN) Uncharacterized protein {ECO:0000313|EMBL:CZG13872.1} KW=Complete proteome OX=446 OS=Legionella pneumophila. GN=ERS240541_00251 OC=Legionellaceae; Legionella.
Sequence
MSKPSNKMKEELEQIRKTEIENAIAKEREDLLAQRNRERAEADDNLKKGRYIKDPRTGQS
ITLWESAVQKAEEVLNADLNSYMDARAAIMSLLKMYYEMVKANAQTMKELRAGIGNTIMD
WGVFPIKDYIGKKLTGNPEIDLPILQHEVSYTDDNKLKIEPLTRSDKREEKGQLDKLFEG
MIHMWLKNNDYTPDRDNPGQFVNSHGETLDKATFDKLKKDDQHGLNHFLTEYDPDLQFRP
SRP
Download sequence
Identical sequences A0A128GUR2
gi|397663992|ref|YP_006505530.1| gi|397667174|ref|YP_006508711.1| gi|54297463|ref|YP_123832.1| 297246.lpp1508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]