SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A131YWN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131YWN8
Domain Number 1 Region: 9-294
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.28e-98
Family Capz alpha-1 subunit 0.0000000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A131YWN8
Sequence length 301
Comment (tr|A0A131YWN8|A0A131YWN8_RHIAP) Capping protein (Actin filament) muscle Z-line, alpha {ECO:0000313|EMBL:JAP82930.1} OX=34631 OS=Rhipicephalus appendiculatus (Brown ear tick). GN= OC=Rhipicephalus; Rhipicephalus.
Sequence
MASDYDEPISDQEKVRIVSDFIQLAPPGEFNEVFNDVRLLLNNDTLLKEKASSAFAQYNK
DQLTPVEIEGSEHQALITHYNDLGEGRFYDPRTRQSFRYDHLRKEATDYQSHPPGSSGDG
SVGLPEGHGESWRAALEEAWTQYAREHYRHGTCAVFDRSPSPQELALVACLEDHQFQAQN
FWNGRWRSVWTVNFPSGAATADVKGLVRVQVHYYEDGNVQLVSSKEIKATLNITNEQQAA
KEFVQIVEDAENEYQTAISENYQAMSDTTFKALRRQLPLTRTKIDWTKILNYKIASELKH
H
Download sequence
Identical sequences A0A131YWN8 A0A224YV64

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]