SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A131ZBX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131ZBX5
Domain Number 1 Region: 53-224
Classification Level Classification E-value
Superfamily MIR domain 1.44e-54
Family MIR domain 0.0000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A131ZBX5
Sequence length 244
Comment (tr|A0A131ZBX5|A0A131ZBX5_RHIAP) Ixodegrin {ECO:0000313|EMBL:JAP88290.1} OX=34631 OS=Rhipicephalus appendiculatus (Brown ear tick). GN= OC=Rhipicephalus; Rhipicephalus.
Sequence
VFRVDAMATWRRTPAATACSAVYTMHSTCWSKISVLFIVLVHLGTLVCADLQYVTCGSVL
KLENQQYQVRLHSHDIKYGSGSGQQSVTGTMDREDNNSHWVVKGKRDKACQRGDPIPCGS
PVRLEHLVTHKNLHSHHFVSPLSNNQEISAFGDGGEGDTGDNWTVVCSSDFWERGSPVRF
KHIDTDTWLCSSGQTYGRPIGGQVEICGLSYPDNSCQWKSVEGIFIKPTDKISSGRLLHD
HSEL
Download sequence
Identical sequences A0A131ZBX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]