SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132A678 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132A678
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily BEACH domain 3.66e-31
Family BEACH domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A132A678
Sequence length 90
Comment (tr|A0A132A678|A0A132A678_SARSC) BEACH domain containing protein 1 {ECO:0000313|EMBL:KPM06462.1, ECO:0000313|VectorBase:SSCA009813-PA} KW=Complete proteome; Reference proteome OX=52283 OS=Sarcoptes scabiei (Itch mite) (Acarus scabiei). GN=QR98_0049380 OC=Sarcoptoidea; Sarcoptidae; Sarcoptinae; Sarcoptes.
Sequence
MNLNSLAGRSYNDLMQYPVFPWILADYQSNELDLNNPSTFRDLSKPMGAQTPERLEQFKK
RFSEWDSDNPIKGGDELNQCPYHYGTFYSR
Download sequence
Identical sequences A0A132A678
SSCA009813-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]