SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A132AET9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132AET9
Domain Number 1 Region: 11-319
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-78
Family Capz alpha-1 subunit 0.00000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A132AET9
Sequence length 325
Comment (tr|A0A132AET9|A0A132AET9_SARSC) F-actin-capping protein subunit alpha-like protein {ECO:0000313|EMBL:KPM08940.1, ECO:0000313|VectorBase:SSCA004352-PA} KW=Complete proteome; Reference proteome OX=52283 OS=Sarcoptes scabiei (Itch mite) (Acarus scabiei). GN=QR98_0074660 OC=Sarcoptoidea; Sarcoptidae; Sarcoptinae; Sarcoptes.
Sequence
MATDSSNDSIMTDSDKLRIVADFILHAPPGQFREVFNGWNYFYFDCSVILFCTYSTDVRH
LLSNDSLLKDKASNIFAQYRKDQLTPAALSDNEFTLITEFNELGSNRFYNPKTKKSFKYD
FLTEETSEIQSWEPDAANEPWRSALEEIWSVYCADHYYNGISSVFATNQHDHFVLSACIE
AHQFQPNNYWLVVAFAILLLMILKSRNGLWRSIWTITFNPNLGKAEIFGKIKAQVHYYEN
GNVQLVSFKEIKDSTSFSSEKQLAENFKSIVEESENEYQVAIAKNYQNMSDTTFKALRRA
LPVTRSKIDWHKIMGYRIGSEIKQT
Download sequence
Identical sequences A0A132AET9
SSCA004352-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]