SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132CAD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132CAD9
Domain Number 1 Region: 64-97
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000247
Family H-NS histone-like proteins 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A132CAD9
Sequence length 98
Comment (tr|A0A132CAD9|A0A132CAD9_9BURK) DNA-binding protein {ECO:0000313|EMBL:KVD77314.1} KW=Complete proteome OX=1637860 OS=Burkholderia sp. ABCPW 14. GN=WS62_31065 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
MVMATYKELLAQLDVLKQQAKTARAVELPDVLVELRRKIVKYGLTQKDLFPPRLGRPKKA
DALPKPRYRDPETGATWTGRGRAPAWIAGQDRERFLIE
Download sequence
Identical sequences A0A132CAD9
WP_066573749.1.71066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]