SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132EYS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132EYS2
Domain Number 1 Region: 52-89
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000785
Family H-NS histone-like proteins 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A132EYS2
Sequence length 103
Comment (tr|A0A132EYS2|A0A132EYS2_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KWF63716.1} KW=Complete proteome OX=1207504 OS=Burkholderia pseudomultivorans. GN=WT57_21790 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MDKFTRYIQRKSELEAQIAKDRALVRDEVLIEIMLAIEEFHFETEELFPTGKKRKVKPRY
FDPQSGAVWSGRGREPRWLKGKNRRDFELEVVETGEALTRNRE
Download sequence
Identical sequences A0A132EYS2
WP_060299329.1.57381 WP_060299329.1.89968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]