SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132F659 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132F659
Domain Number 1 Region: 89-181
Classification Level Classification E-value
Superfamily Barstar-related 7.06e-24
Family Barstar-related 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A132F659
Sequence length 188
Comment (tr|A0A132F659|A0A132F659_9BURK) Barnase inhibitor {ECO:0000313|EMBL:KWF70982.1} KW=Complete proteome OX=1207504 OS=Burkholderia pseudomultivorans. GN=WT57_10460 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MSDSIYAHEAAAELFAAGDGNLFQRVMQLRATAQAEAAPPEQREAVDPGLSSNEEPMSLF
TTVRPNLVQSIRAFRVQDLADEAGRLGQHFLYAYCGAAQSKQEVMETIATSFLFPKHFGK
NYDALYDCLTDLVAKAGAQPGFVIVLEGLPIAQKFDKEGRETLLDVFREAAEFWAERKVA
FRVFYSFA
Download sequence
Identical sequences A0A088U101 A0A132F659 F0GE94
WP_009693463.1.101246 WP_009693463.1.2175 WP_009693463.1.50630 WP_009693463.1.57381 WP_009693463.1.65410 WP_009693463.1.74755 WP_009693463.1.77406 WP_009693463.1.82257 WP_009693463.1.89968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]