SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132PJZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132PJZ2
Domain Number 1 Region: 10-195
Classification Level Classification E-value
Superfamily BB2672-like 1.2e-56
Family BB2672-like 0.0000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A132PJZ2
Sequence length 206
Comment (tr|A0A132PJZ2|A0A132PJZ2_9MYCO) Peptide synthetase {ECO:0000313|EMBL:KWX22656.1} KW=Complete proteome; Reference proteome OX=59750 OS=Mycobacterium wolinskyi. GN=AFM11_19360 OC=Mycobacterium.
Sequence
MQERISGVSLGLRKVVVYRETVVTEAGVRPACPALQASVAAVVRNPWVGTGPARDLSPEV
ARIAPVLAQLVTRRLIDTLGGVDAVEAFGKAAIVGLDGEIEHGGALIHTPYFGNLMREFL
DGESIICFADARAEAGDPLIVPLWHKTHAATRSHYQTVSTRVPDGPRADEIVIIAAGSTG
PRPHPRIGDRTTDPAVTVKSLESVLS
Download sequence
Identical sequences A0A132PJZ2
WP_067851707.1.86893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]