SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A133U5E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A133U5E7
Domain Number 1 Region: 10-115
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.000000000785
Family HEPN domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A133U5E7
Sequence length 124
Comment (tr|A0A133U5E7|A0A133U5E7_9EURY) Uncharacterized protein {ECO:0000313|EMBL:KXA89398.1} KW=Complete proteome; Reference proteome OX=1698260 OS=candidate divison MSBL1 archaeon SCGC-AAA259B11. GN=AKJ61_02965 OC=Archaea; Euryarchaeota; candidate division MSBL1.
Sequence
MENSKKIQKYMNSAREWLRAAEKVVEAEPNPAAFNALHAIELAAKACLMDETGEEFTTHQ
IGGSFGKHFREEIGERKAKRLNRLMMEYSRLRYPNAKSINSEESKKILKFAKEFVKDTVP
TLLQ
Download sequence
Identical sequences A0A133U5E7 A0A133UJ86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]