SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A133ZVH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A133ZVH2
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 0.0314
Family Protein prenylyltransferase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A133ZVH2
Sequence length 39
Comment (tr|A0A133ZVH2|A0A133ZVH2_9FUSO) Uncharacterized protein {ECO:0000313|EMBL:KXB59426.1} KW=Complete proteome OX=157687 OS=Leptotrichia wadei. GN=HMPREF3180_02368 OC=Leptotrichia.
Sequence
MKKKNKALRFVPFYYTIYHKQKTFFYHLNKLEKIDIIRI
Download sequence
Identical sequences A0A133ZVH2 U2QD88

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]