SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A134CHT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A134CHT9
Domain Number - Region: 36-134
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0994
Family Capz alpha-1 subunit 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A134CHT9
Sequence length 147
Comment (tr|A0A134CHT9|A0A134CHT9_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KXB91669.1} KW=Complete proteome OX=1588748 OS=Veillonellaceae bacterium KA00182. GN=HMPREF3182_00691 OC=Bacteria; Firmicutes; Negativicutes; Veillonellales; Veillonellaceae.
Sequence
MKKRISFMLMGIVTCVSMLLAGCGQGDSYAGTWVGYYAAKPHVIYITKIQKQEKGYLISV
EDAYWQKNAAGQFVWKNDILPTVTGSIVQGRLVVDHKLNLVSYTYRDENDVLIYSNRTSN
AVILFHKIKKNEIEEFKAKMKTSVSAP
Download sequence
Identical sequences A0A134CHT9 F9MNA1
WP_007392286.1.50830 WP_007392286.1.53336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]