SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A135RRN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135RRN2
Domain Number 1 Region: 454-715
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-86
Family Capz alpha-1 subunit 0.00000345
Further Details:      
 
Domain Number 2 Region: 78-281
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.19e-64
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000049
Further Details:      
 
Domain Number 3 Region: 266-391
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-34
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A135RRN2
Sequence length 722
Comment (tr|A0A135RRN2|A0A135RRN2_9PEZI) Transketolase {ECO:0000313|EMBL:KXH26394.1} KW=Complete proteome OX=1460502 OS=Colletotrichum nymphaeae SA-01. GN=CNYM01_05282 OC=Colletotrichum.
Sequence
MRSSSISLRPLRRALAPSVSTQLLPPLVTGPRLYSTHPPNAKLNIPVDYATTSLLAHSSQ
TALGTAELPAEVRDGTAKKMNLFQAINDALSIALAEDDSVMVFGEDVAFGGVFRCTMKLA
ETYGADRIFNTPLTEQGIMGFAIGAAAEGMRPVAEIQFADYIYPAFDQLVNEAAKYRYRD
GACGRSVGGLTVRMPCGGVGHGALYHSQSPESLFTHIPGLRVIMPRSPLQAKGLLLAAIR
SNDPCIFMEPKILYRAAVEQVPAGAYTLPLSKAEVLKEGKDVTIISYGQPLYTCMSAIQK
AEEELGISVELIDLRTLYPWDKETVFQSVRKTGHCIVVHEAMVNAGIGAEVAATIQEDPD
TFLRLEAPVARVAGWSIHTPLLYEKFNIPDVATNPPLPISHLQPPRITFQRSREADSSPF
TPYSRNRHRLNDRLIARAEPLTLPAAPDRNLTMSQVETVSSFVEGAPPGELADVIADIKS
LTVSDPEIVSSLEPAFEKYNEEQFVTVKLPGGSQQVIVSAHSSLGDGQYFDVESSTSFSF
DHTTQKASNVQSYVLESANSDLIKSTLKSLGPYVQEHFPNAAYGVYPTENDSKVAVIIVS
NKYSPNNFWNGRWRSVYIFDPSSEALEGSVKVDVHYYEDGNVRLLTSRSSQASVSSGTGA
GIVKEIAASEKKYQEELNRGFTSLSEGAFKGLRRQLPVTRQKIEWDKITSYRLGQDIGGG
RK
Download sequence
Identical sequences A0A135RRN2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]