SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A135S8U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135S8U2
Domain Number 1 Region: 58-109
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.6e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00056
Further Details:      
 
Domain Number 2 Region: 9-59
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 4.19e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A135S8U2
Sequence length 115
Comment (tr|A0A135S8U2|A0A135S8U2_9PEZI) Transcription initiation factor IIA subunit 2 {ECO:0000256|PIRNR:PIRNR009415} KW=Complete proteome OX=1460502 OS=Colletotrichum nymphaeae SA-01. GN=CNYM01_06799 OC=Colletotrichum.
Sequence
MAAAPQSFYELYRRSSIGLALTDMLDDLISEERIHPQLAMKILANFDQAITEALQKSVKA
RLTFKGSLSTYRFCDEVWTFLIKNVQFKLDNGGQIVTADKVKIVSCNAKKPGEGP
Download sequence
Identical sequences A0A010RP92 A0A066XL68 A0A135S059 A0A135S8U2 A0A135U5K4 A0A161VU56 A0A162PYB0 A0A1G4BL73 E3QIC1 H1VU39
EFQ30736 XP_007602427.1.78992 XP_008094756.1.39555 XP_018161028.1.57863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]