SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A135URU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A135URU9
Domain Number 1 Region: 427-703
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-82
Family Capz alpha-1 subunit 0.00000451
Further Details:      
 
Domain Number 2 Region: 77-281
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.33e-64
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000459
Further Details:      
 
Domain Number 3 Region: 266-392
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.38e-35
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A135URU9
Sequence length 710
Comment (tr|A0A135URU9|A0A135URU9_9PEZI) Transketolase {ECO:0000313|EMBL:KXH63134.1} KW=Complete proteome; Reference proteome OX=1209931 OS=Colletotrichum salicis. GN=CSAL01_08173 OC=Colletotrichum.
Sequence
MRSSSISLRPLRRALAPSVSTQLLSPLVAAPRLYSTHPPNAKLNIPVDYATTSLLAHSSQ
TALGTAELPAEVRDGTTKKMNLFQAINDALSIALAEDDSVMVFGEDVAFGGVFRCTMKLA
ETYGADRIFNTPLTEQGIMGFAIGAAAEGMRPVAEIQFADYIYPAFDQLVNEAAKYRYRD
GACGRSVGGLTVRMPCGGVGHGALYHSQSPESLFTHIPGLRVIMPRSPLQAKGLLLAAIR
SNDPCIFMEPKILYRAAVEQVPTGSYTLPLSKAEVLKEGKDVTIISYGQPLYTCMSAIQK
AEEELGISVELIDLRTLYPWDKETVFQSVRKTGHCIVVHEAMVNAGIGAEVAATIQEDPD
TFLRLEAPVARVAGWSIHTPLLYEKFNIPDVATAIVTDLTTDLLRDQNLFPPTPPPPAVP
DYNLTMSQVETVSSFVEGAPPGELADVIADEETKSSERIANAGQDIKSLTVSDPEIVSSL
EPAFEKYNEEQFVTVKLPGGSQQVIVSSHSSLGDGQYFDVESSTSFSFDHTTQKASNVQS
YVLESANSDLIKSTLKSLGPYVQEHFPNAAYGVYPTEDDSKVAVIIVSNKYSPNNFWNGR
WRSVYIFDPSSEALEGSVKVDVHYYEDGNVRLLTSRPGQASVSSGTGAGIVKEIAASEKK
YQEELNRGFMNLSEGAFKGLRRQLPVTRQKIEWDKITSYRLGQDIGGGRK
Download sequence
Identical sequences A0A135URU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]