SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A136JB74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A136JB74
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.87e-21
Family Ubiquitin-related 0.00041
Further Details:      
 
Domain Number 2 Region: 258-320
Classification Level Classification E-value
Superfamily XPC-binding domain 2.35e-21
Family XPC-binding domain 0.00039
Further Details:      
 
Domain Number 3 Region: 313-378
Classification Level Classification E-value
Superfamily UBA-like 7.53e-16
Family UBA domain 0.0015
Further Details:      
 
Domain Number 4 Region: 127-187
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000281
Family UBA domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A136JB74
Sequence length 383
Comment (tr|A0A136JB74|A0A136JB74_9PEZI) XPC-binding domain-domain-containing protein {ECO:0000313|EMBL:KXJ94298.1} KW=Complete proteome; Reference proteome OX=196109 OS=Microdochium bolleyi. GN=Micbo1qcDRAFT_159398 OC=Microdochium.
Sequence
MKVTFKDLKQQKFTLDAEPTDLVSTIKQRISEEKGWDPKAQKLIYSGKILKDEDTLEKYN
IEEKGFVVCMVNKPKVAPAAPAASSSSSAVPQTPARSVTATPAAPAAPAAAPSAAPAAVP
ATPSPAPATQAEPAPTDSSMAMGAAREGAITEMLAMGFERSQIDAALRAAFFNVDRAVEY
LLTGIPEGVQQSQSQAAAQQAPPPPPPAPSAALAGGDVEGDGGVNLFDLAAQAGRGGARG
GANPASPGPGGAAGARDLGNLDFLRNNPQFQQLRQVVQQQPQMLEPILQQLGAGNPNLAQ
LITQNPEQFLNLLGEEGDDDAPLPPGAQAISVTEEERDAIERLCRLGFDRDAAIQAYFAC
DKNEELAANFLFDQPDDDEPAQN
Download sequence
Identical sequences A0A136JB74

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]