SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A136JW35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A136JW35
Domain Number 1 Region: 215-261
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000112
Family AraC type transcriptional activator 0.02
Further Details:      
 
Weak hits

Sequence:  A0A136JW35
Domain Number - Region: 123-221
Classification Level Classification E-value
Superfamily BEACH domain 0.0149
Family BEACH domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A136JW35
Sequence length 270
Comment (tr|A0A136JW35|A0A136JW35_9BACT) AraC family transcriptional regulator {ECO:0000313|EMBL:KXK01378.1} KW=Complete proteome; Reference proteome OX=1617411 OS=Chlorobi bacterium OLB4. GN=UZ04_CHB001002237 OC=Bacteria; Chlorobi.
Sequence
MTHSADIYFPATETEKYFIKSIWRLQEFYTHKQTETILPKGTVELIFNLSDKITYINSVS
DVRTTLPPCFINGINFKPFQLIKNGQQLFVGIQLNVIALKALFEIPAMEFNDAIVESSQV
CKSLNDLYNQLFSERTFEGQVEIIRKWLYHKISTSRYLAAAQKFHNWFYFPNVNTMTVQE
LGNRACISERQLRRLSTEWLGMNIEAFLLYSKYLSSLYLLHNSDLSLTQIGLEAGYYDQS
HFIREFKSYTDLTPKEYQASVTGLPGHIFL
Download sequence
Identical sequences A0A136JW35
2031456481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]