SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A136ML95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A136ML95
Domain Number 1 Region: 45-146
Classification Level Classification E-value
Superfamily NosL/MerB-like 0.00000000000000549
Family NosL-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A136ML95
Sequence length 147
Comment (tr|A0A136ML95|A0A136ML95_9BACT) Nitrous-oxide reductase accessory protein NosL {ECO:0000313|EMBL:KXK34628.1} KW=Complete proteome; Reference proteome OX=1617413 OS=Chlorobi bacterium OLB6. GN=UZ06_CHB003001091 OC=Bacteria; Chlorobi.
Sequence
MTLRLSCLLLTLLFLVACSEPAPRGINYDKEQCASCKMGITDQKFGAEIVTKKGKIFVFD
APECMINYIQAGTVSSDDVHSLWVTNFLEPGTLIKAETACYLHSDMIHSPMTLDVAAFKD
SATCEKVRLNFAGDVLNFDAVRKLVLQ
Download sequence
Identical sequences A0A136ML95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]