SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A137NRA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A137NRA3
Domain Number - Region: 74-165
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 0.00981
Family Fascin 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A137NRA3
Sequence length 206
Comment (tr|A0A137NRA3|A0A137NRA3_CONC2) Uncharacterized protein {ECO:0000313|EMBL:KXN65271.1} KW=Complete proteome; Reference proteome OX=796925 OS=(Delacroixia coronata). GN=CONCODRAFT_13198 OC=Entomophthoromycetes; Entomophthorales; Ancylistaceae; Conidiobolus.
Sequence
MIVWFAWEYFGEGLELVKGKENAVKVQALWTDDTRKAQSLPTQIPEAITDNKNTAMSLEG
FQILPNTSKNFRILLNGNSYHYATEFDGQFHFGRDNYTTGVKFQLIKVNNNNSLSLYNPE
LGYLGRGKNEYDSDCVKYYKDMPNDVVYLEPVKEKLGVYRLKCENNSSNEGGEEYARIDF
IKANCGLSNFTKDLKRAAIIQFVLDY
Download sequence
Identical sequences A0A137NRA3
jgi|Conco1|13198|gm1.11438_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]