SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139M860 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139M860
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily PTS IIb component 1.7e-45
Family PTS IIb component 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A139M860
Sequence length 156
Comment (tr|A0A139M860|A0A139M860_STROR) PTS system, mannose-specific IIA or IIB component {ECO:0000313|EMBL:KXT59928.1} KW=Complete proteome OX=1303 OS=Streptococcus oralis. GN=SORDD05_01435 OC=Streptococcus.
Sequence
MAVELVRIDDRLIHGQVATTWTRNYEIEQILIINDEAKNDPVQHSVANFAVPAGVKVMIF
GVKQFAEVMKKSDIKKRTMLLFTNPIDIKFLVDEGLQINEVNAGGMRFRDGRRRLEKAIS
VTDEEHQAFLDLMDKEIHINVQMVPKDPRIDYRTLI
Download sequence
Identical sequences A0A139M860
WP_061418446.1.14100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]