SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A139XRE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139XRE4
Domain Number 1 Region: 4-43,100-168
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.05e-20
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A139XRE4
Sequence length 173
Comment (tr|A0A139XRE4|A0A139XRE4_TOXGO) Putative capping alpha-like subunit {ECO:0000313|EMBL:KYF41345.1} KW=Complete proteome OX=1074872 OS=Toxoplasma gondii ARI. GN=TGARI_208390C OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
AAARTSYWEVYFSVATQRLVIEGEVRLRSHTCEDWNAQVDYRRRFVSREAAAGKGETVGT
DNSEEREQKNGNDTPQTAEHLPPEARAKGVSEKHGKRVADWQEGLYVENCRDVEDPTALA
RHVIEFIKTKETDVLSDEKHYFHVYVPDTLRSLRRVLSLTGRSFDWQQQSLQL
Download sequence
Identical sequences A0A139XRE4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]