SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A140VK94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A140VK94
Domain Number 1 Region: 5-157
Classification Level Classification E-value
Superfamily CATH 6.64e-71
Family CATH 0.001
Further Details:      
 
Domain Number 2 Region: 26-160
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-67
Family Ran-binding domain 0.0000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A140VK94
Sequence length 201
Comment (tr|A0A140VK94|A0A140VK94_HUMAN) Testis secretory sperm-binding protein Li 221n {ECO:0000313|EMBL:AEE61231.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_17886 OC=Catarrhini; Hominidae; Homo.
Sequence
MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKV
AEKLEALSVKEETKEDAEEKQ
Download sequence
Identical sequences A0A096NQA6 A0A0D9RHX8 A0A140VK94 A0A2K5M2C5 A0A2K5WQQ1 F7GMJ1 H2P3N6 K7DGV8 P43487
ENSP00000327583 1k5dB ENSP00000327583 NP_002873.1.87134 NP_002873.1.92137 XP_002830910.2.23681 XP_005568005.1.63531 XP_007973190.1.81039 XP_011738124.1.29376 XP_011948721.1.92194 XP_015005213.1.72884 XP_514990.3.37143 ENSPPYP00000012932 9600.ENSPPYP00000012932 9606.ENSP00000327583 1k5d_B 1k5d_E 1k5d_H 1k5d_K 1k5g_B 1k5g_E 1k5g_H 1k5g_K ENSPPYP00000012932 gi|4506407|ref|NP_002873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]