SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A142CZ27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A142CZ27
Domain Number - Region: 15-58
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0301
Family Apolipoprotein 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A142CZ27
Sequence length 62
Comment (tr|A0A142CZ27|A0A142CZ27_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AMQ20029.1} KW=Complete proteome OX=1813182 OS=Geobacillus sp. JS12. GN=A0V43_02510 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MKKTANSLKRPDGDKRMAVLRLELDYELATLYEAMMENDEEKKKECKRRLEKLRQELMRL
QV
Download sequence
Identical sequences A0A063YZC7 A0A0J0V270 A0A0K2H6J7 A0A142CZ27 A0A1C3D4X3 A0A1Q5T365 A0A1V4P6R3 A0A1V9C0E7 A0A2H5KFR0 Q5L128 T0Q556
gi|56419602|ref|YP_146920.1| 235909.GK1067 544556.GYMC61_1840 WP_011230567.1.100150 WP_011230567.1.13089 WP_011230567.1.13458 WP_011230567.1.17728 WP_011230567.1.19233 WP_011230567.1.20723 WP_011230567.1.2219 WP_011230567.1.22479 WP_011230567.1.22874 WP_011230567.1.25743 WP_011230567.1.25789 WP_011230567.1.3446 WP_011230567.1.38260 WP_011230567.1.38928 WP_011230567.1.45808 WP_011230567.1.46340 WP_011230567.1.50933 WP_011230567.1.57889 WP_011230567.1.59104 WP_011230567.1.60903 WP_011230567.1.6497 WP_011230567.1.65208 WP_011230567.1.70239 WP_011230567.1.72400 WP_011230567.1.76536 WP_011230567.1.77642 WP_011230567.1.78869 WP_011230567.1.80994 WP_011230567.1.8599 WP_011230567.1.86012 WP_011230567.1.90668 WP_011230567.1.91533 WP_011230567.1.9165 WP_011230567.1.92435 WP_011230567.1.93593 gi|261419264|ref|YP_003252946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]