SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A142VV93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A142VV93
Domain Number 1 Region: 41-145
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000654
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.047
Further Details:      
 
Domain Number 2 Region: 170-291
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.000000263
Family HEPN domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A142VV93
Sequence length 310
Comment (tr|A0A142VV93|A0A142VV93_9SPHN) Nucleotidyltransferase {ECO:0000313|EMBL:AMU93197.1} KW=Complete proteome OX=1219058 OS=Sphingopyxis terrae NBRC 15098. GN=AOA14_01095 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MRTDITHLPARGQRELEAIVQAIFEEFEDAHKLANGERKAGRILKVILYGSMARGEGIYE
PHTEKGYVSDYDILVIVNQVELTDHEYWYHLENRLARDYMVLHRLRHPVSLIVHTLQEVN
NNLADGRFFFLDVVKDAVALYQSDDSELATPRPKRPADALALAREYFDEWYPSAGEFFAM
FEAAQNQGFRKNAAFQLHQATERLYHTLLLTCTLYTPHSHNLENLRNQARKVDRRLVHVW
PDDDRQSRRRFSLLKDAYVKARYSKHYRISAEDLAWLGERVQELSAIVREICTEKLAELE
RAAASESGNI
Download sequence
Identical sequences A0A0W1CNG5 A0A142VV93
WP_058804226.1.101919 WP_058804226.1.65670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]