SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A142YY19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A142YY19
Domain Number 1 Region: 61-97
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000122
Family H-NS histone-like proteins 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A142YY19
Sequence length 100
Comment (tr|A0A142YY19|A0A142YY19_9BURK) H-NS histone {ECO:0000313|EMBL:AMV44109.1} KW=Complete proteome; Reference proteome OX=75105 OS=Paraburkholderia caribensis. GN=ATN79_15660 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MSQYADLKAQIARLQQEADEARRSEVGNVIAEIRQKIAEYGLNAHDLGFAEAARRGRPPK
KAPLPAKYQDPKSGNTWSGRGKPPKWIAGKNRERFLIGQA
Download sequence
Identical sequences A0A0P0R5Z0 A0A142YY19 A0A1G8ESU3 A0A1H6HVE5 A0A235GTC0 A0A244DHI9 A0A2C8Z9I6 I5CW66
WP_007581545.1.10406 WP_007581545.1.12721 WP_007581545.1.14847 WP_007581545.1.20617 WP_007581545.1.25358 WP_007581545.1.38198 WP_007581545.1.50346 WP_007581545.1.57484 WP_007581545.1.68487 WP_007581545.1.77641 WP_007581545.1.80201 WP_007581545.1.8162 WP_007581545.1.87037 WP_007581545.1.92040 WP_007581545.1.9395 WP_007581545.1.96914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]