SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A142ZBB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A142ZBB3
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily BB2672-like 3.01e-71
Family BB2672-like 0.000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A142ZBB3
Sequence length 195
Comment (tr|A0A142ZBB3|A0A142ZBB3_9BURK) Peptide synthetase {ECO:0000313|EMBL:AMV48723.1} KW=Complete proteome; Reference proteome OX=75105 OS=Paraburkholderia caribensis. GN=ATN79_49670 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MKLEVRKLVTYLEETFIEGGKEAQRPLKLFGAAAVLRNPWAGRGFVEDLKPEIHGLAPQL
GEMLTAEMLRVAGSGDAIEGYGKAAIVGTSGEIEHASALIHTLRFGNHYRKAVGAKSYLS
FTNLRGGPNCPISIPLMHKHDEGMRSHYLTVQFSIVDAPAPDELVIALGASIGGRPHHRI
GDRYQDLKELESNEA
Download sequence
Identical sequences A0A142ZBB3
WP_062918619.1.92040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]