SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A143HSW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A143HSW4
Domain Number - Region: 52-113
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0288
Family Capz alpha-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A143HSW4
Sequence length 124
Comment (tr|A0A143HSW4|A0A143HSW4_ENTAS) Flagellar protein FliT {ECO:0000313|EMBL:AMX04596.1} KW=Complete proteome OX=61645 OS=Enterobacter asburiae. GN=A0R60_0284 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MNNPSAALSHWQALHAQSIAMLNLAHSGQWDALIEQEMHYVQLVEKISQTPIMSCPPAQV
EQARALLEMILENENALKALLKVRMDELRNLIDQTGKQQSITSTYGKLSGNILYPESFTR
DTQL
Download sequence
Identical sequences A0A143HSW4 A0A263VXU2
WP_023312297.1.24603 WP_023312297.1.2977 WP_023312297.1.3154 WP_023312297.1.36400 WP_023312297.1.3683 WP_023312297.1.49555 WP_023312297.1.49946 WP_023312297.1.56233 WP_023312297.1.6296 WP_023312297.1.65764 WP_023312297.1.65924 WP_023312297.1.71175 WP_023312297.1.7202 WP_023312297.1.79753 WP_023312297.1.83680 WP_023312297.1.83860 WP_023312297.1.86654 WP_023312297.1.90049 WP_023312297.1.93726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]