SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146CL37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146CL37
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily FlgN-like 3.92e-21
Family FlgN-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146CL37
Sequence length 155
Comment (tr|A0A146CL37|A0A146CL37_9BACI) Flagellar biosynthesis protein FlgN {ECO:0000313|EMBL:AMX82301.1} KW=Complete proteome OX=129338 OS=Geobacillus subterraneus. GN=GS3922_00550 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MTFAELIHLLRAQAELHESLVALARRKTEALKKNDIGALSALLADEQKHLFAIRQLEERR
RRWLKEKLGDETVTIAACQAMAKGEERQPLRECGERLMAAVHALAEANDLNRQLIEQSLQ
FVTAMIETFAPTPSTYSRTQEYAPSPDRPLFESKA
Download sequence
Identical sequences A0A146CL37
WP_063164728.1.46395 WP_063164728.1.93963 WP_063164728.1.97756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]