SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146F7W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146F7W1
Domain Number 1 Region: 91-160
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.44e-29
Family Cyanase C-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 12-86
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000237
Family Cyanase N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146F7W1
Sequence length 160
Comment (tr|A0A146F7W1|A0A146F7W1_9EURO) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_03139} KW=Complete proteome; Reference proteome OX=1069201 OS=Aspergillus luchuensis. GN=RIB2604_01100940 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSLATLDTAQHPNLPSASETLFKAKAAKKLSFEQIAQHIGRNEVATAAIFYGQAKASPED
IEKLASLLTIPHDALEERLSGFPDRGRTVEMPPKEPLIYRLYEIVQNYGYAYKAVLNEKF
GDGIMSAISFSTKVEKETDADGNNWAVITLRGKWLPFSRF
Download sequence
Identical sequences A0A146F7W1 A0A1M3TFX1 G7XZ21
jgi|Aspfo1|46665|fgenesh1_kg.7_#_96_#_Locus1276v1rpkm158.65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]