SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146FAC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146FAC5
Domain Number 1 Region: 56-298
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.93e-79
Family Capz alpha-1 subunit 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146FAC5
Sequence length 304
Comment (tr|A0A146FAC5|A0A146FAC5_9EURO) F-actin capping protein alpha subunit {ECO:0000313|EMBL:GAT22503.1} KW=Complete proteome; Reference proteome OX=1069201 OS=Aspergillus luchuensis. GN=RIB2604_01505370 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MASTTELASSFIEGAPPGEHLLARRRRRRYAMQFRPFISIVAISIVPRTKPILSSSTDVK
ALTSDGPDIIPSLAPAFERYNETQLTTVKLPGASQEVLISEYNKLEGNRYFDVESQTSFE
VDHVTQEASAAQSYVLESQNADLIKSLLKSLSAHATEHYRTCSYGVYPIEDDTAVAIVLV
ANRYSPNNFWNGRFRAIYTLPVNSSSTTISGQIKVDVHYYEDGNVALNTNKPVNLSVPSV
DASSIISRIAAAERDYQEELNRAFVSTAEGVFKGLRRQLPITRQKVEWEKVGGYRLGQDI
AGGR
Download sequence
Identical sequences A0A146FAC5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]