SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146L7A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146L7A0
Domain Number 1 Region: 243-429
Classification Level Classification E-value
Superfamily MIR domain 2.79e-61
Family MIR domain 0.0000000555
Further Details:      
 
Domain Number 2 Region: 431-599
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.71e-52
Family IP3 receptor type 1 binding core, domain 2 0.000000496
Further Details:      
 
Domain Number 3 Region: 1106-1134,1167-1275
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.96e-35
Family IP3 receptor type 1 binding core, domain 2 0.0056
Further Details:      
 
Domain Number 4 Region: 112-200
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000863
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146L7A0
Sequence length 2718
Comment (tr|A0A146L7A0|A0A146L7A0_LYGHE) Inositol 1,4,5-trisphosphate receptor {ECO:0000313|EMBL:JAQ03465.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=g.33060 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MTETIGNTSFLHLGDIVSLFAEGNVCGFLSTLGLVDDRTVVCPEAGDLTSPPKKFRDCLF
KICPMNRYSAQKQFWKAAKQNSNSTSTTDAVLLKRLHHAAEIEKKQNDSENKKLLGMVVQ
YGMVIQLLHLKSNKYLTVNKRLPALLEKNAMRVYLDANGNEGSWFYILPYYKLRSTGDNV
VVGDKVIMNPVNAGPQVVLHVSANYDLPDNIGCKEVNVVNTNTPWKVNLFMEHQENQDEI
LKGGEVIRLFHAEQEKFLTMDEYKKKQHVFLRTTGRTSATAATSSKALWEVEVVQHDPCR
GGAGHWNCLFRFKHLATGHYLAAEVDDDNTMDQMRSKLRDAHGGPVYHLVSVPHTNEISS
LFELDPTTLTRGDSLVPQSSYVRLHHLCTNTWVHSTSIPIDKDEEKPVMSKVGCAAVKED
KEAFALIPVSPTEVRDLDFANDACKVLAANSTKLEKGSISPNERRAVTSLLQDIVYFIAG
LENEQNKSEALDLIVLNPNRDRQKLLREQYILKQLFKILQAPFMETNSGEPFLRIEELND
PRHAPYKYMFRLCYRILRLSQQDYRKNQEYIAKHFAFMQKQIGYDILAEDTITALLHNNR
KLLEKHITAAEIETFVNLVRRNMHNWESRFLDYLSDLCISNKKAIAITQELICKSVLSQK
NADILIETRTIKLQRKEKLEPAEHEIENEEVSLLWDNEKKQGSLVELSHEAKLGNQTTFA
LLDYYRHQLNLFSNMCLNRQYLALNNLSPHLDIDLILKCMADENVSYELRASFCRLMLHL
HVDRDPQEPVTPVKYARLWSEIPSKMSINDYDTNKTPDLNKEAVRAKFSSTIMFVEDYLC
NVVAKMWSFTDQYQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLSILDCVSENDINR
KIPTAEIHSEGGVLRSIGDMGAVVTGLTLATGISRGGSLNASQPKSTPQNKKEYPLVMDT
KLKIIEILQFILDVRLDYRISCLLSIFKCEFDSAEKPLMENVPIGQKPIDLEAIGTQAEG
IFGHSGECEILDLDGHGGRTFLRVLLHLTMHDYPPLVSGALHLLFRHFSQRQEVLQAFKQ
VQLLVSDSDVESYKQIKSDLDVLRQSVEKSELWVYKCKTDDGVTKIKEKDEDDDISSSRA
GKPKTMLGSTGKQHSTSDMDPMLHSDQMKEYTKIQLILQRMNALCVTPSGKPRKHEQRLL
RNVGVHTVVLDLLQVPYDQKEDIRMNNLISLAHQFLQNFCLGNQQNQVLLHKHLDLFLNP
GILEAETICSIFRDNYTLCNEVNEKVVQHFIHCIETHGRHVQYLKFFQTIVKAENQFIRK
SQDMVMQELVNAGEDVLVFYNDKASFSQFVSMMLSERHRMDESSPLRYHIELVKLLACCT
MGKNVYTEIKCHSLLPLDDIVAMVSHPDCIPEVKEAYTNFLNHCYIDTEVEMKEIYASNH
MWSLFEKSFIVDMGVVANSPHDRRHVDIAMENYVTSTVMAIITTFFSSPFSDQSTIIQAR
QPIFVQLLHSAFRVSQCTWLNPTQHFNVENCIRTLAEVAKNRSIAIPSDLESQVATMFTK
SNLLSRQTSKWLQATKTPKIERSQSQLMKLDRSIIEGLQDIVLLLEDQLKPLVQAELSML
VDVLYSPELLFPSGTEARKRCESGGFIRRLIKHTEKLLEEKEEKLCVKVLRTLREMMAID
NDYGEKGDVLRGSLLTRYFGKQPGHKKDGPPVEISIPTQPSSITHGPGGKLLNRAGRTLH
DVQCHLDREGASDLVVELVIKSVHSPSIFVEAVELGIALLEGGNPIIQKSMYNKLLGGDL
SQAFFKVFYDKMKESQQEIKSTVTVNTSDLAQKAHEDKEHSKEIEKLNKRKGKSNGMVIT
EEIRDELNQAAVATSQAYSGTRALAPGEEGSSVVIGSALEDMLAEKLERSRDRDDHHLSE
KVLVMQPILRFLQLLCENHNRYLQNTLRNQNNKSNYNLVSETLMFLDCICGSTTGGLGLL
GLYINEYNVSLINQTLETLTEYCQGPCHDNQNCIATHESNGLDIITALILNDINPLGKTR
MDLVLELKNNASKLLLAIMESRGDSENAERILSNMNPKQLVDVACRAFHQESIEDSLDND
DNGTDVDDGVTPKEVGHNIYILCHQLAQHNKDLAELLKPSDINIDPKVNQALEYYASHTA
QIEIVRHDRTLEQIVFPIPEICEYITHETKAKVLHTAERDDQGSKVSDFFEKSEDMFSEM
KWQKKLRGQPALFWVSSYMSLWSNVLFNCAVLINLIVAFFYPFTDTVPKLGAHLSGLIWA
VMLISAAIVITLPRESGIRTLVASTILRMIFSAGPEPTLWLLGTLTVFLKGIHLISIMGN
QGTFSKSIRQIITDGEIIYHLSYVMFCILGLCMHPFFYSVLLLDVVYREETLLNVIKSVT
RNGRSIILTAVLALILVYMFSIIGYMFFKDDFLVHIDGEIIPLENEAQLFDESCPSEGEC
KFYKPNAEEYKSSAATLKDLDDDKERACDSLIMCIVTTLNQGLRNGGGIGDILRAPSSHE
PLFVARVVYDLLFFFVVIIIVLNLIFGVIIDTFADLRSEKQQKELILKNTCFICGLNRSA
FDNKTVSFEEHIKCEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMIKDRNLDWFPRLRA
MSLSADESEGETIELRSLQAQLELTQKLVQTLSSQLSQLKDQMTEQRKQKQRIGLLNSTS
TYLHHRGGDFADSIIYKP
Download sequence
Identical sequences A0A146L7A0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]