SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A146MXQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146MXQ4
Domain Number 1 Region: 247-332
Classification Level Classification E-value
Superfamily Moesin tail domain 3.53e-32
Family Moesin tail domain 0.0000271
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily PH domain-like 0.0000197
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146MXQ4
Sequence length 332
Comment (tr|A0A146MXQ4|A0A146MXQ4_FUNHE) Radixin {ECO:0000313|EMBL:JAQ24494.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MGNHDLYMRRRKPDTIEVQQMKAQAKEEKQQKQMERAHLENEKKKREAIEKEKDQMEREK
QDLMMRLYQFEEKTKKAEKEKQDLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
RAMMLEQERRRAEEEAARLEAERQAALLAKEELARQAESQLKTQEQLAAELAEHSAKIAL
LEEARKRKEEEASQWQNRALEVQDDLNKTREELHMVLTVPPPPPPPPVYNHMDDNSDSED
NNSMSSRDLMMDDFHDHRMEEDRLTEVEKNERVQKQLKALTSELAQARDDTKNTQNDLLH
SENVRAGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences A0A146MXQ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]