SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146UG91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146UG91
Domain Number 1 Region: 37-209
Classification Level Classification E-value
Superfamily MIR domain 9.42e-54
Family MIR domain 0.00000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146UG91
Sequence length 215
Comment (tr|A0A146UG91|A0A146UG91_FUNHE) Stromal cell-derived factor 2 {ECO:0000313|EMBL:JAR04130.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
STMLSLRQRLCSNAHTIWLLILVFTIKHEASTSSPVVTYGSTVKLLNNYYKMRLHSHDIA
YGSGSGQQSVSGMGSMDDHGSYWQILAKFGNETNRGLPVKCGDVIRLMHLNTRRYLHTHD
FSSPLSNQQEVSAFGSDEIGDHLDNWVVECPNRGAELWTRNLEVRLKHEETKMYLHLSGQ
TYSHHITGQMEVVATKTKSKANLWKAAEGVYMKIK
Download sequence
Identical sequences A0A146UG91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]