SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146VD63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146VD63
Domain Number 1 Region: 234-433
Classification Level Classification E-value
Superfamily MIR domain 7.41e-64
Family MIR domain 0.000000012
Further Details:      
 
Domain Number 2 Region: 435-600
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.71e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000492
Further Details:      
 
Domain Number 3 Region: 1121-1138,1170-1281
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.97e-32
Family IP3 receptor type 1 binding core, domain 2 0.0088
Further Details:      
 
Domain Number 4 Region: 106-217
Classification Level Classification E-value
Superfamily MIR domain 9.42e-19
Family MIR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146VD63
Sequence length 2765
Comment (tr|A0A146VD63|A0A146VD63_FUNHE) Inositol 1,4,5-trisphosphate receptor type 1 {ECO:0000313|EMBL:JAR15238.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPDAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGGNTDTVLLNKLHHAADLEKKQNDSENKKLLGTVIQYGNVIQ
LLHLKSNKYLTVNKRLPALLEKNAMRVMLDTAGNEGSWFYIQPFYKLRSIGDSVVIGDKV
VLNPVNAGQPLHASTHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNRECVLKGGDVVRL
FHAEQEKFLTCDDHRKKQYVFLRTTGRQSATSATSSKALWEIEVVQHDPCRGGAGYWNSL
FRFKHLATGHYLAAEVTSEYEEECPDFCSPLDSEPNTLRPRLKNVQDKVFYTLISVPDGN
DISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNQPIDKEEEKPVMLRIGTSG
HKEDKEAFAIVPVSPAEVRDLDFANDASKVLASIAGKLEKGTITQNERRAVTKLLEDLVF
FVVDIPNNGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELA
DQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFRFMQKQIGYDVLAEDTITALLHNN
RKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICTAVLDPANA
DILIETKLVLSRFEIEGAQLGENSVEAEEDEEEVWLFWKNSDKEIRSKSIRELAQDAKEG
QKEDKEVINYYRYQLNLFARMCLDRQYLAINKISIQLDVDLILRCMSDEDLPYDLRASFC
RLMLHMHVDRDPQEQVTPVKYARLWSEIPSEICINDYDNDGTTKDKIKERFSQTMEFVEN
YLRDVVCQHFPFADKEKNKLTSEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVNT
IFPFTKLDKADVSRGSNVMRSIHGVGELMSQVVLRGGGFLPIDPNTGSDGDTVKTQIEPE
KQDILVMDTKLKIIEILQFILNVRLDYRISCLLSIFKREFDESNSQSELSIGGAVEGPNN
MPGALDFEHIEEQAEAIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHEYPPLVSRALHLL
FRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKEDLDKLRSIVEKSELWVYKRQGPDEGL
DGGDGLPAERDLQKEDSAATDKPRKPESSSSKNYRVIKEVLLRLSRLCIQEGVSGRKSRK
QQQRLLRNMGAHSVVLELLQIPYEKGEDVRMQDNMKLAHQFLQNFCAGNQQNQALLHKHI
NLFLTPGILEAVTMQHIFRNNFQLCSEINERVVQHFVHCIETHGRNVQYLKFLQTIVKAE
SKFIKKCQDVVMAELVNAGEDVLVFYNDRASFQTLVQMMRSERDRMDENSPLRYHIHLVE
LLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEIKIAYINFLNHCYVDTEVEMKE
IYTSNHMWKLFDNFLVDICRVCNNTSDRKHADAVLERYVTETVMSIVTTFFSSPFSDQST
TLQTRQPVFVQLLQAVFRVYHCYWLGSGQKGSVETCIKVLSDVAKSRAIAIPVDLDNQVN
NLFVRSNNIVQRTAISWRLSVRNSQLSTRRESVVTVSRDYRNIIERLQDIVSALEDRLRP
LVQAELSVLVDVLHRPELLFPENTDSRKKCESGGFICKLIKHTKQLLEENEEKLCIKVLQ
TLREMMTKDRGYGEKGEALRQILVSRYYGNFHRSGGRRDSLTSFGNGPLSPVGPGRSQSA
LGGPGGLSRGEMTLAEVQCHLDKEGASDLVIDLIMNTTSDRVFQESILLAIALLEGGNTT
IQRSFFCRLTDDKKSEKFFRVFYDRMKSAQQEIKATVTVNTSDLGNRRRDDDSQDKDVPA
RKKARDAAVAMTEDVKEQLIEASSATKKAFNSYRREADPEDHCTSADGLPSAGANNHEEK
MSFVIVIMQPILRFLQLLCENHNRDLQNFLRCQNKKNNYNLVCETLQFLDCICGSTTGGL
GLLGLYINKDNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIIIALILNDINPLG
KKRMDLVLELKNNASKLLLAIMESRHDSENAERILYNMKPKELVEVIKKAYLQGEVEFVD
IKEEEDPRDEEEHDAASPRNVGHNIYILAHQLARHNKELSMMLKPGGPSGDGDEALEFYA
KHTAQIEIVRQDRTMEEIVFPVPNICEFLTSESKLRVYYTTERDEQGSKINDFFLRAEDL
FNEMNWQKKLRAEPVLYWCSRNMSVWSSISFKLALLMNLMVCLFYPLEGVHGEMLEPRLS
ALLWMGLFAALVLVVLMPQPLGILALVAITILRLIFSVGLEPTLFLLGAFNVCNKIIFLI
SFVGNRGTFTRGYKAMVIDFEFLYHLIYLIICCLGVFGHVFFYSLLLFDLVYREETLLNV
IKSVTRNGRSIVLTAVLALILVYLFSIVGYIFFKDDFILEVDHIANTTQKSGGSLAGEFL
STGMCQGGIDENCSTNTQQEEVVIDDDEDENNMERTCDSLLMCIVTVLSHGLRSGGGVGD
VLRKPSKEEPLFAARVVYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTC
FICGLERDKFDNKTVTFEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XRSCVFCRIFHFYQHYEVQVVLVKVKDSTEYTGPESYVAEMIKEHNLDWFPRMRAMSLVS
SDSEGEQNEIRSLQEKLESTMRLVINLSGQLTELKEQMTEQRKHKQRIGLLGHPPHLNIN
PQQPA
Download sequence
Identical sequences A0A146VD63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]