SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146XAV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146XAV2
Domain Number 1 Region: 33-129
Classification Level Classification E-value
Superfamily MIR domain 2.62e-32
Family MIR domain 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146XAV2
Sequence length 148
Comment (tr|A0A146XAV2|A0A146XAV2_FUNHE) Stromal cell-derived factor 2 1-like protein {ECO:0000313|EMBL:JAR39243.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MERLCLFPGLLQWLLLPLFLLLLSGCEGRESELDYVTCGSLVKLLNTRHNVRLHSHDVKY
GSGSGQQSVTGVESADDANSYWQIRGKPAHPCQRGSAIKCGQAIRITHMKTSRNLHTHHF
SSPLSNNQVREWHILVLHQQAVSVGRTE
Download sequence
Identical sequences A0A146XAV2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]