SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146YJ11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146YJ11
Domain Number 1 Region: 308-503
Classification Level Classification E-value
Superfamily MIR domain 3.66e-63
Family MIR domain 0.0000000772
Further Details:      
 
Domain Number 2 Region: 505-672
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.44e-51
Family IP3 receptor type 1 binding core, domain 2 0.000000452
Further Details:      
 
Domain Number 3 Region: 1263-1412
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.32e-33
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 179-290
Classification Level Classification E-value
Superfamily MIR domain 3.4e-18
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146YJ11
Sequence length 2829
Comment (tr|A0A146YJ11|A0A146YJ11_FUNHE) Inositol 1,4,5-trisphosphate receptor type 3 {ECO:0000313|EMBL:JAR53625.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MSDSASSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLENPPKKFRDCLFKV
CPMSRYSAQKQYWKAKQAKHEKDKIGDVVLLQKLQHASNLEQKQNEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLEKNAMRGLEKDKIGDVVLLQKLQHASNLEQKQNETENK
KVHGDVVKYGTVLQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWLFIQPFWK
LRANGDNVVVGDKVILNPVNAGQPLHASNYELSDHPGCKEVNSVNCNTSWKINLFMMFSD
HREEVLKGGDVVRLFHAEQEKFLTCDEYKSKLHVFLRTTLRQSATSATSSNALWEVEVVH
HDPCRGGAGHWNSLYRFKHLATGNYLAAEENPAYKGDAADLSASMDKSRISKRSLGERIK
FKLMVVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIHSTNVPIDIDEER
PIRLMLGTCPTKEDKEAFAIVSVPVMEIRDLDFANDASAMLATVVEQFSSGFISQNDRRF
AIKLLEDVVFFVADVANSGQPVLDVVMTKPNRERQKLMREQNILKQIFGILKAPFKDRGE
GEGALLQLEELADQKNAPYQYMLRLCYRVLRHSQDDYRKNQEHIAKQFGVMQSQIGYDIL
AEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNNVAIPVTQE
LICKCVLDPKNQDILIKTERRVPKEAPPGVVVGEYLGMDDYGDEDEVWLMWMDKNSEKQE
KSIRQLAQEARQGNAHDENVLTYYRYQLKLFARMCLDRQYLAIDEISKQLDVELIFLCMM
DETLPFDLRASFCRLMLHAHVDRDPQELVTPVKFARLWTEIPTSITIKDYDSNLDDSRDN
KKNRFANTMVFMEEYLNNVLNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXNRFANTMVFMEEYLNNVLNDDLPFHNEEKNKLTYEVVSLARHLIYFGF
YSFFELLRLTRTLLGIIDCRPNPAHTTLPFQEEGSGRNVRRTIHGMGQMMSTMVLNRRQS
TFGGSGPRGAGFALEGQRGSKDSIDNLDLTVMDTKLKILEILQFILNVRLDYRISFLLSV
FKKEFVDVYPMGEADATTNMEQAAAINLPQIGDQAEAMFGVGKVNSILEVDDEGGRMFLR
VLIHLTMHNYAPLVSGALQLLFRHFSQRQEVLHTFKQVQLLISAQDVENYKLIKADLDRL
RTLVEKSELWVEKKSSGGEGKKDKKDKKEKGEGASVEPSPKKQKPQKGNESYQNVKEILE
RLNRMCSTGVWKKQQRLLKNMGAHKVMLDLLQVSYDKSDVKMQEIIKYTHMFLQKFCMGN
QENQALLHKNLNLFLNPGLQEAETVQHIFSNNYQLCSEISESVLQHFIHCLATHGRHVQY
LNFLHTIIKAEGKYVKKCQDMIMTELTNAGEDVVVFYNDKASFNAMLELMAESREGVDES
SPLRYHISLVELLAACAEGKNVYTEIKCTSLLPLEDVVRVVTHEDCITEVKVAYVNFVNH
CYVDTEVEMKEIYTSNHIWKLFEDFTVDMARVCNKREKRLSDPVLEKYIINVVFDTINAF
FSSPFSENSTSLQTHHTIVIQLLQSSVRLLDCPWLQQQHRGQVETCIKTLSLTAKNRSIS
LPLELEAQINNVLASSAQNTLSRSNPNYKSSTRSSRPIVSSNPWDYKNIIEKLQDIINTL
EDRLKPLVNAELSVLVDVLHQPELLFLEGTDARQRCESGGFISKLIQHTKALMSSEEKLC
IKVLRTLQEMLIRTLDFDEKGMSLRKVLLQNYLFSNKKINQKNELAELGVAGGEQERDWA
AVAAIQCRLDREGGTKLFTDLVMSSKNDKIFQESIQLAICLLEGGNTEIQNSFYKLMMGD
NKSEKFFKVLHDRMKEAQTDIKATVSVNVGEMTHKASEKELEAGGSATLVLPGSGGHPLL
VQGQSIAPVSGASALPALPAEEQREVETEMGPAVTIMKPILRFLQLLCENHNNDLQNFLR
SQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINESNVHLIIQTLETLTEYCQGPCQ
ENQTCIVTHESNGIDIITALILNDISPLCRYRMEMVLQLKDNASKLLLALMESRHDNENA
ERILFNLRPRELVDEIKKAYHQDSECEDVEVEVSPREVGHNIYILAQQLARHNKVLQNLL
KPPKNGKEGEEGISSMLNLNNRPLSQMLKSTAPAEVVDQDPLEYYDQLTAQIEIVREDRS
MEQIVFPVHPICEFLTEESKVRVFNTTEQDEQGSKVTHFFEQTSFLHGEMEWQKKLRSMP
VLYWFSRRMTLWGTISFNLAVFINLIIAFFYPYDSGQGAIDDSMLLMLFWILTGLSVLGL
VSKQYGLQPLTLALILRSIYHLGIGNTLILLGSLNLINKVVYVVSFVGNNGTFIMGYKAM
VMDVEFLYHLAYVLTSTLGLFVHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTAL
LALILVYLFSILGFLFLKEDFIMEVDPLLQISADPQQTEASQDFLKSCSADGVSCTDETR
VETVAEEEEEPNTERACDTLLMCIVTVLNHGLRNGGGVGDVLRKPSKNEPLFPARVVYDL
LFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEH
IKLEHNIWNYLYFIVLVREKNKTDYTGPESYVAHMIKNNNLDWFPRMQAMSLVVTDGDGE
QNEMRMLQDKLGSTMKVVITLTGQLNELKEQMTEQRKRRQRMGFADIQAGGSGALPPTAA
GGNHQIYKP
Download sequence
Identical sequences A0A146YJ11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]