SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146YJR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146YJR3
Domain Number 1 Region: 269-464
Classification Level Classification E-value
Superfamily MIR domain 3.31e-63
Family MIR domain 0.0000000772
Further Details:      
 
Domain Number 2 Region: 466-622
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-45
Family IP3 receptor type 1 binding core, domain 2 0.000000965
Further Details:      
 
Domain Number 3 Region: 1183-1332
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.92e-33
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 141-251
Classification Level Classification E-value
Superfamily MIR domain 3.92e-18
Family MIR domain 0.013
Further Details:      
 
Domain Number 5 Region: 1324-1392,1470-1737,1961-2070
Classification Level Classification E-value
Superfamily ARM repeat 0.00000173
Family MIF4G domain-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146YJR3
Sequence length 2639
Comment (tr|A0A146YJR3|A0A146YJR3_FUNHE) Inositol 1,4,5-trisphosphate receptor type 3 {ECO:0000313|EMBL:JAR53627.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MSDSASSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLENPPKKFRDCLFKV
CPMSRYSAQKQYWKAKQAKHEKDKIGDVVLLQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXKLQHASNLEQKQNETENKKVHGDVVKYGTVLQLLHMKSNKYLTVNKRLPALLEKNAM
RVTLDGTGNEGSWLFIQPFWKLRANGDNVVVGDKVILNPVNAGQPLHASNYELSDHPGCK
EVNSVNCNTSWKINLFMMFSDHREEVLKGGDVVRLFHAEQEKFLTCDEYKSKLHVFLRTT
LRQSATSATSSNALWEVEVVHHDPCRGGAGHWNSLYRFKHLATGNYLAAEENPAYKGDAA
DLSASMDKSRISKRSLGERIKFKLMVVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLR
HLCTNTWIHSTNVPIDIDEERPIRLMLGTCPTKEDKEAFAIVSVPVMEIRDLDFANDASA
MLATVVEQFSSGFISQNDRRFAIKLLEDVVFFVADVANSGQPVLDVVMTKPNRERQKLMR
EQNILKQIFGILKAPFKDRGEGEGALLQLEELADQKNAPYQYMLRLCYRVLRHSQDDYRK
NQEHIAKQFGVMQSQIGYDILAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNNVAIPVTQELICKCVLDPK
NQDILIKTERRVPKEAPPGVVVGEYLGMDDYGDEDEVWLMWMDKNSEKQEKSIRQLAQEA
RQGNAHDENVLTYYRYQLKLFARMCLDRQYLAIDEISKQLDVELIFLCMMDETLPFDLRA
SFCRLMLHAHVDRDPQELVTPVKFARLWTEIPTSITIKDYDSNLDDSRDNKKNRFANTMV
FMEEYLNNVLNDDLPFHNEEKNKLTYEVVSLARHLIYFGFYSFFELLRLTRTLLGIIDCR
PNPAHTTLPFQEEGSGRNVRRTIHGMGQMMSTMVLNRRQSTFGGSGPRGAGFALEGQRGS
KDSIDNLDLTVMDTKLKILEILQFILNVRLDYRISFLLSVFKKEFVDVYPMGEADATTNM
EQAAAINLPQIGDQAEAMFGVGKVNSILEVDDEGGRMFLRVLIHLTMHNYAPLVSGALQL
LFRHFSQRQEVLHTFKQVQLLISAQDVENYKLIKADLDRLRTLVEKSELWVEKKSSGGEG
KKDKKDKKEKGEGASVEPSPKKQKPQKGNESYQNVKEILERLNRMCSTGVWKKQQRLLKN
MGAHKVMLDLLQVSYDKSDVKMQEIIKYTHMFLQKFCMGNQENQALLHKNLNLFLNPGLQ
EAETVQHIFSNNYQLCSEISESVLQHFIHCLATHGRHVQYLNFLHTIIKAEGKYVKKCQD
MIMTELTNAGEDVVVFYNDKASFNAMLELMAESREGVDESSPLRYHISLVELLAACAEGK
NVYTEIKCTSLLPLEDVVRVVTHEDCITEVKVAYVNFVNHCYVDTEVEMKEIYTSNHIWK
LFEDFTVDMARVCNKREKRLSDPVLEKYIINVVFDTINAFFSSPFSENSTSLQTHHTIVI
QLLQSSVRLLDCPWLQQQHRGQVETCIKTLSLTAKNRSISLPLELEAQINNVLASSAQNT
LSRSNPNYKSSTRSSRPIVSSNPWDYKNIIEKLQDIINTLEDRLKPLVNAELSVLVDVLH
QPELLFLEGTDARQRCESGGFISKLIQHTKALMSSEEKLCIKVLRTLQEMLIRTLDFDEK
GMSLRKVLLQNYLFSNKKINQKNELAELGVAGGEQERDWAAVAAIQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLDREGGTKLFTDLVMSSKNDKIFQESIQLAICLLEGGNTEIQNSFY
KLMMGDNKSEKFFKVLHDRMKEAQTDIKATVSVNVGEMTHKASEKELEAGGSATLVLPGS
GGHPLLVQGQSIAPVSGASALPALPAEEQREVETEMGPAVTIMKPILRFLQLLCENHNND
LQNFLRSQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINESNVHLIIQTLETLTEY
CQGPCQENQTCIVTHESNGIDIITALILNDISPLCRYRMEMVLQLKDNASKLLLALMESR
HDNENAERILFNLRPRELVDEIKKAYHQDSECEDVEVEVSPREVGHNIYILAQQLARHNK
VLQNLLKPPKNGKEGEEGISSMLNLNNRPLSQMLKSTAPAEVVDQDPLEYYDQLTAQIEI
VREDRSMEQIVFPVHPICEFLTEESKVRVFNTTEQDEQGSKVTHFFEQTSFLHGEMEWQK
KLRSMPVLYWFSRRMTLWGTISFNLAVFINLIIAFFYPYDSGQGAIDDSMLLMLFWILTG
LSVLGLVSKQYGLQPLTLALILRSIYHLGIGNTLILLGSLNLINKVVYVVSFVGNNGTFI
MGYKAMVMDVEFLYHLAYVLTSTLGLFVHELFYSILLFDLIYREETLFNVIKSVTRNGRS
ILLTALLALILVYLFSILGFLFLKEDFIMEVDPLLQISADPQQTEASQDFLKSCSADGVS
CTDETRVETVAEEEEEPNTERACDTLLMCIVTVLNHGLRNGGGXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRCIPWFKLSGH
Download sequence
Identical sequences A0A146YJR3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]