SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146ZFS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146ZFS0
Domain Number 1 Region: 1-190
Classification Level Classification E-value
Superfamily MIR domain 8.37e-49
Family MIR domain 0.00000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146ZFS0
Sequence length 196
Comment (tr|A0A146ZFS0|A0A146ZFS0_FUNHE) Stromal cell-derived factor 2 {ECO:0000313|EMBL:JAR64682.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
TYGSTVKLLNNYYKMRLHSHDIAYGSGSGQQSVSGMGSMDDHGSYWQILAKFGNETNXDH
GSYWQILAKFGNETNRGLPVKCGDVIRLMHLNTRRYLHTHDFSSPLSNQQEVSAFGSDEI
GDHLDNWVVECPNRGAELWTRNLEVRLKHEETKMYLHLSGQTYSHHITGQMEVVATKTKS
KANLWKAAEGVYMKIK
Download sequence
Identical sequences A0A146ZFS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]