SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146ZTH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146ZTH6
Domain Number 1 Region: 237-435
Classification Level Classification E-value
Superfamily MIR domain 2.27e-57
Family MIR domain 0.000000118
Further Details:      
 
Domain Number 2 Region: 437-602
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.96e-52
Family IP3 receptor type 1 binding core, domain 2 0.000000478
Further Details:      
 
Domain Number 3 Region: 1148-1292
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.75e-32
Family IP3 receptor type 1 binding core, domain 2 0.0083
Further Details:      
 
Domain Number 4 Region: 111-218
Classification Level Classification E-value
Superfamily MIR domain 1.83e-17
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146ZTH6
Sequence length 2698
Comment (tr|A0A146ZTH6|A0A146ZTH6_FUNHE) Inositol 1,4,5-trisphosphate receptor type 2 {ECO:0000313|EMBL:JAR69202.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MSEQRSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVQPEAGNLRNPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQGKQGNSNPQGELFKKLKHAAELEQKQNETESKKVLGVVVEYSS
VIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDPAGNEGSWFCIQPFWKLRSEGDNVVVG
DKVVLMPVSAGQPLHASNIELLDNLGCKEVNALNCNTSWKVNLFMKFSEYKEDILKGGDV
VRLFHAEQEKFLTGDEYNKRQHVFLRTTLRQSATSATSSKALWEIEVVHHDPCRSGAGQW
NSLFRFKHLATGNYLAAEKNHEYTNGSGMPKGENETDDTYDKRKNQAAEKIAYTLVSVPD
GDDISSLFELDATTLQRADCLVPRNSYVRLRNVCTNTWVTSTNIAIDTEEERPVMLKIGT
CATKEDKEAFAIVSVPLSEVRDLDFANDANQVLESTVKKLKHANITQNERRFVTSLLEDL
IFFVCMVPNNGQDVLSVVINTPNRERQKLMREQNILYQIFGILKEPFEGGKDGPMLRLEE
LGDQRYCHFKYMFKLCYRVLRHSQQDYRKNQEYIAKKFPIMQSQMGYEILAEDTITALLH
NNRKLLEKHITSREIETFVNLLRRNREPRFLDYLSDLCASNKTAIPVTQELIIKFVLNAA
NADILIKTKLVSNSDHSLDSSLSPDDGDEEEVWLYWIDSHKEPHGKSIRHLAQDAKNNHK
NDLELLTYYRCQLNLFAKMCLDRQYLAINQISTHLPVDLILRCMFDDCLPYNLRASFCRL
MLHMHVDCEPQEAVVPVRYARLWTEIPSKISIREFEYDSKDNSREDTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKRTFKSTMEFVDDYLKDVVSQLYPFGDEEKNELTLEVVNLARH
LVYFGFYNFSELLRLTRTLLAILDIVQQPSGLQSKLNKSPEAGNNVMRTIHGVGEMMTQM
VMSRGVMHGLSETSPSPLNGKGAIAPDNEDVVVMDTKLKIIEILQFILSVRLDYRITYLL
SIYKKEFGENAFPDSSCSFADFLPIASSEPDMDEIAAKAESMFIGSSELSVLELDDEGGR
TFLRVLIHLIMQDYPPLVSGSLQLIFKHFSQRAEMLQAFKQVQLLVSEQDVHNYTQIKED
LDKLRLIVEKSELWVEKSGIYNDELADAVLSPVQDLENKLQMDSNQENNYDLLTKILERF
SKMCAVNKKNRLQLQRLLKNMGAHTVVLDLLQIPYEKSDEKMIGIMKMAHTFLQNFCKGN
PENQVLLHKHLNLFLSPGLLEAETMRHIFMNNNQLCNEVSDRVVQHFVHCIETHGRRVQY
LRFLQTIVKCDRMYMKKCQDKVMTELVNAGEDVLVFYNDRSSFLVLLQMMASEEERADEN
GSLAYHNTLVDLLAACTEGKNVYTELKCNSLLPLDDIVKVVTDVNCIPEVKTSYVNFVNH
CYVDTEVEMKEIYTSSHIWRLFENFLVDMDTMCKTAERSRLDPLAKYVTETVMAIIKSFF
ESPFSLNHSMLQNNQSTFIKLLQSAFRIYSLKGINTSQKNNIETCIKALADVAKARSIPI
PVDLDSQVNTLSLNVHTNAVQRAAKDWRTSARSRPRREPLGSPDYKNIIEKLQGVVSGLE
DHFCPKVQAEFSVLVDVLRSPELLFPEGTQIRCKSGAFMSKLITHTKKLMDQEEKLCIKI
LETIREMMEKKESFQESGNELRKILLARYIGNQKLPSKSEGGSGSGSSGGFVKQSSGGSS
SLDSDKPGSSMVEIQCLLDKVGATELVIDLIVNTKNDRVFEESILLGIALLKGGNTQIQN
SFYNQLYKQKNSEKFFKVLYDRMNTAQQDIRSTVSVNMFDFSCRKREDDSSLCSNRFRKE
KDSTLYIKDDMRGQLKEASSATSKAISSYRNELDPDPEYFGQTSEAASADEPEEEPAMSW
SITIMNPVLRYLQLLCENHNSDLQNFLRHQHNKTNYNLVCETLQFLDCICGSTTGGLGLL
GLYINENNVDLVRQTLETITEYCQGPCHENQTCIAKHESNGIDIIIALIVNSINPLGENH
LDLVLDLKNAASKLLLAIMESRHDSENAEKILYKMRPTELVDVMKEAYAQGLGAEEGMES
AGDRIKARDVGHNIYILALQLARHNKILQQCLRPSLAPALDEVKDAALSYYAKHTAQIEI
VRHDRSMEKIVFPVPNICEYLTEEAKTCVFTTTERDDQGSKVNDFFQQFDNLYNGMRWQK
KIRENKPLFWFSRHMSLWGSISFYLACVLNLTVATFYPFGDDGDEGTLSPFWNILLWVAL
GVSTFLLPVLPKQWGIVSFLVSLILRAIYTMGLKPALFLLGSFNLFNKLVFLVSFVGNQG
TFVRGYKAVVMDLVFVCHLSYAFICVLGLFVHEFFYSILLIDLVFREETLLNVIKSVTRN
GRSIILTAILALFLVYFFSIIGFMFFKNDFRMEVDPLLGRPELLCDDGSAGSSAKDSCPA
SSASKSLPDNDDGVERVCDTLRMCIITVLNQGLRNGGGVGDILRRPSKEEPLFAARVIYD
LLFFFIVIIIVLNLIFGVIIDTFADLRSEKQRKEEILKTSCFICGLERDKFDNKTVSFEE
HIKSEHNMWHYLYFLVLVRVKDPTEYTGPESYVAQMIAEKNLDWFPRMRAMSLVSNEGDG
EQNEIRSLQEKLDHTSALVSQLSTQLSELREQMTEQRKNKQRLGFLSPPQPNQHFPTH
Download sequence
Identical sequences A0A146ZTH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]