SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A147B5Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A147B5Q8
Domain Number 1 Region: 62-125
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.0000000000000328
Family Interleukin 8-like chemokines 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A147B5Q8
Sequence length 146
Comment (tr|A0A147B5Q8|A0A147B5Q8_FUNHE) C-X-C motif chemokine 10 {ECO:0000313|EMBL:JAR86128.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
SQQYLRGPLAALQSTNLLLHHLDHTPQEPKREKSKMSGIMKVFLLLAVAICISKAQLNEP
GQSCLCQRVRNRMAPKSDIKDIQIYPATIFCPKVEIVVTSGRGFRYCLNPELQAVKRMLT
RIIKANTTAKPTSPQATSGSSSTAQM
Download sequence
Identical sequences A0A147B5Q8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]