SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150FN52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150FN52
Domain Number 1 Region: 34-118
Classification Level Classification E-value
Superfamily FlaG-like 6.54e-25
Family FlaG-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150FN52
Sequence length 118
Comment (tr|A0A150FN52|A0A150FN52_CLOPD) Flagellar protein FlaG protein {ECO:0000313|EMBL:KXZ39063.1} KW=Complete proteome; Reference proteome OX=1121328 OS=[Clostridium] paradoxum JW-YL-7 = DSM 7308. GN=JWYL7_0138 OC=Peptostreptococcaceae.
Sequence
MRIDSIQNINTVNLNKQDNLPKQSNEKADVSKEIKNKEENVSFPGERKLIEAIEKANKEL
LGMDTSLKFSIHEKTKQITVKVIDNKTEEVIREIPPEKILDMVYDMLEKTGLFVDKKV
Download sequence
Identical sequences A0A150FN52
WP_066067575.1.80640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]