SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150GC12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150GC12
Domain Number 1 Region: 19-71
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000000101
Family DEK C-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A150GC12
Sequence length 94
Comment (tr|A0A150GC12|A0A150GC12_GONPE) Uncharacterized protein {ECO:0000313|EMBL:KXZ47391.1} KW=Complete proteome; Reference proteome OX=33097 OS=Gonium pectorale (Green alga). GN=GPECTOR_35g829 OC=Chlamydomonadales; Volvocaceae; Gonium.
Sequence
MLADAAAAAGGGGGQAARRAMPSDEEVKAAAAAVLRVSDVSRVNMKNLMAALQERFGVDL
TAKRQWIQKYAAGFADEQAKARSGSRPGITSSGR
Download sequence
Identical sequences A0A150GC12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]