SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150L3Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150L3Z0
Domain Number 1 Region: 22-146
Classification Level Classification E-value
Superfamily YojJ-like 3.27e-30
Family YojJ-like 0.0033
Further Details:      
 
Domain Number 2 Region: 243-357
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000207
Family Hef domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150L3Z0
Sequence length 360
Comment (tr|A0A150L3Z0|A0A150L3Z0_BACVA) Diadenylate cyclase {ECO:0000256|HAMAP-Rule:MF_01438} KW=Complete proteome OX=72361 OS=Bacillus vallismortis. GN=B4144_0149 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MEKEKKGAKQELDLSAILQFVAPGTPLRAGIENVLRANTGGLIVVGYNDKVKEVVDGGFH
INTSFAPAHLYELAKMDGAIILSDSGQKILYANTQLMPEATISSSETGMRHRTAERVAKQ
TGCLVIAISERRNVITLYQENMRYTLKDIGFILTKANQAIQTLEKYKTILDKTITALNAL
EFEELVTFSDVLSVMHRYEMVLRIKNEINMYIKELGTEGHLIRLQVIELITDMEEEAALF
IKDYVKEKIKDPFVLLKELQDMSSYDLLDDSIVYKLLGYSASTNLEDYVLPRGYRLLHKI
PRLPMPIVENVVEAFGVLPRIIEASAEELDDVEGIGEVRAQKIKKGLKRLQEKHYIDRQL
Download sequence
Identical sequences A0A080UAA0 A0A0H3E622 A0A150L3Z0
WP_010787418.1.100936 WP_010787418.1.10353 WP_010787418.1.15971 WP_010787418.1.16994 WP_010787418.1.30485 WP_010787418.1.32777 WP_010787418.1.39473 WP_010787418.1.39900 WP_010787418.1.40255 WP_010787418.1.45236 WP_010787418.1.48649 WP_010787418.1.52389 WP_010787418.1.53439 WP_010787418.1.59507 WP_010787418.1.62747 WP_010787418.1.68581 WP_010787418.1.69262 WP_010787418.1.72801 WP_010787418.1.7305 WP_010787418.1.7508 WP_010787418.1.79721 WP_010787418.1.94463 WP_010787418.1.96443 gi|311070735|ref|YP_003975658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]